Page 1 of 1

PROBLEM: The sequence presents a residue (0) not recognized

Posted: 2017.09.18 10:06
by Julie2222
I get the error 'PROBLEM: The sequence presents a residue (0) not recognized' when running EOM.
All letters in the seq file are uppercase, i tried both with and without the first line in the fasta format and checked my sequence 100 times. Anyone who knows how to solve the problem? I am using MAC.

Cheers,
Julie

Re: PROBLEM: The sequence presents a residue (0) not recogni

Posted: 2017.09.19 15:02
by Hayds
Hi Julie,

can you please pm me your sequence file? Is the EOM run using any PDB files or just random structure?

Re: PROBLEM: The sequence presents a residue (0) not recogni

Posted: 2017.09.19 15:35
by Julie2222
It is a 7 domain protein and i have used 7 different pdb structures. I had a hard time understanding which sequence the EOM actually need so i tried both with the sequence of the protein tested with SAXS and all the sequences of the pdb structures. I tried using the sequences in fasta format but naming the file seq.seq and also tried without the fasta headers.

Re: PROBLEM: The sequence presents a residue (0) not recogni

Posted: 2017.09.19 16:04
by Hayds
Hi Julie,

try removing all the non-alphabetical characters from the sequence files, you should only have something like this:

MLLAQKPFWQRHLAYPHINLDTVAHSLRLTGPLDTTLLLRALHLTVSEIDLFRARFSAQG
ELYWHPFSPPIDYQDLSIHLEAEPLAWRQIEQDLQRSSTLIDAPITSHQVYRLSHSEHLI
YTRAHHIVLDGYGMMLFEQRLSQHYQSLLSGQTPTAAFKPYQSYLEEEAAYLTSHRYWQD
KQFWQGYLREAPDLTLTSATYDPQLSHAVSLSYTLNSQLNHLLLKLANANQIGWPDALVA
LCALYLESAEPDAPWLWLPFMNRWGSVAANVPGLMVNSLPLLRLSAQQTSLGNYLKQSGQ
AIRSLYLHGRYRIEQIEQDQGLNAEQSYFMSPFINILPFESPHFADCQTELKVLASGSAE
GINFTFRGSPQHELCLDITADLASYPQSHWQSHCERFPRFFEQLLARFQQVEQDVARLLA
EPAALAATTSTRAIAS

Just plain text. Remove any spaces and "/" or "{" for example.

Let me know how it goes.

Cheers,

Haydyn

Re: PROBLEM: The sequence presents a residue (0) not recogni

Posted: 2017.09.19 16:39
by Julie2222
I have tried that many times and it results in the same error. Can anything else give that error, when the sequence is fine?

Re: PROBLEM: The sequence presents a residue (0) not recogni

Posted: 2017.09.21 09:17
by Hayds
Hi Julie,

I just removed all the extra characters and EOM runs fine with the modified sequence file (EOM run without using any rigid bodies, just random coil from sequence).

In your case I assume you have corresponding rigid bodies. Do you have anything in the PDB files that is unusual?

Cheers,

Haydyn